PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400040389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 458aa    MW: 51895.6 Da    PI: 7.3082
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400040389genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.42.2e-3154111260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           dDgy+WrKYGqK+vkgs+fprsYY+Ct+++C v+kkve++  +++v+ei+Y+g Hnh+k
  PGSC0003DMP400040389  54 DDGYTWRKYGQKQVKGSNFPRSYYKCTQQNCLVRKKVECAP-NGQVIEIVYNGAHNHPK 111
                           8****************************************.***************85 PP

2WRKY105.23.5e-33248305259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dgy+WrKYGqK+vkg+++prsYY+CtsagC v+k+ver+a+d k v++tYeg+Hnhe
  PGSC0003DMP400040389 248 EDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCIVRKHVERAADDFKSVITTYEGKHNHE 305
                           8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-2745111IPR003657WRKY domain
PROSITE profilePS5081122.48148112IPR003657WRKY domain
SuperFamilySSF1182901.57E-2450111IPR003657WRKY domain
SMARTSM007743.3E-3453111IPR003657WRKY domain
PfamPF031061.1E-2454110IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-35232307IPR003657WRKY domain
SuperFamilySSF1182901.57E-28240307IPR003657WRKY domain
PROSITE profilePS5081137.482242307IPR003657WRKY domain
SMARTSM007746.9E-37247306IPR003657WRKY domain
PfamPF031065.3E-25248305IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MQTPTENVGQ ILNCIESRNN EIPQQEEEYS KKQNQQFEQR GIFSSSISAN NSSDDGYTWR  60
KYGQKQVKGS NFPRSYYKCT QQNCLVRKKV ECAPNGQVIE IVYNGAHNHP KTQHLRRKTT  120
DDIYVVAQEN GSSLWRNDQQ FEYNRDVAGL ERIPPAPVLS DASDPMLSNN INVFESHEIS  180
SKLTIFDAED EDLATQEGNF LGDGINEYEL ETKRRKKDGY LAEPSFLSRT VREPKVVLQV  240
ASEIDILEDG YRWRKYGQKV VKGNPNPRSY YKCTSAGCIV RKHVERAADD FKSVITTYEG  300
KHNHEVPSTN KTNGVSGNVR SASMLNNGQQ PCTTTSRKSL KDSNIRVQFQ DLPIPFERKH  360
FMGSEYLRPS FGASYLGDLS FGATSLQLPD FPLPLPLPSR MSFPARQNES HFHLNNNFLL  420
PNGASDSFLA DGNTQHIIAD NNNSRLLKAK DEIQYWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-3354308878Probable WRKY transcription factor 4
2lex_A2e-3354308878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573837.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ6VWJ66e-76WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLM1C5480.0M1C548_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000600420.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57672237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.17e-72WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]